Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZDHHC16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159446
|
Novus Biologicals
NBP159446 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZDHHC16 Polyclonal specifically detects ZDHHC16 in Human samples. It is validated for Western Blot.Specifications
| ZDHHC16 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| Q969W1 | |
| 84287 | |
| Synthetic peptides corresponding to ZDHHC16(zinc finger, DHHC-type containing 16) The peptide sequence was selected from the N terminal of ZDHHC16. Peptide sequence SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DHHC domain containing 16, EC 2.3.1, EC 2.3.1.-, zinc finger, DHHC-type containing 16 | |
| ZDHHC16 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title