Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC18 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZDHHC18 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160124
|
Novus Biologicals
NBP160124 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZDHHC18 Polyclonal specifically detects ZDHHC18 in Human samples. It is validated for Western Blot.Specifications
ZDHHC18 | |
Polyclonal | |
Rabbit | |
Q9NUE0 | |
84243 | |
Synthetic peptide directed towards the middle region of human ZDHHC18. Peptide sequence: SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
DHHC domain containing 18, DHHC18, DHHC-18, EC 2.3.1, EC 2.3.1.-, zinc finger, DHHC-type containing 18 | |
ZDHHC18 | |
IgG | |
Affinity Purified | |
42 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title