Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZFHX2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179998

 View more versions of this product

Catalog No. NBP179998


Add to cart

Description

Description

ZFHX2 Polyclonal antibody specifically detects ZFHX2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

ZFHX2
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZFHX2
Synthetic peptide directed towards the middle region of human ZNF409. Peptide sequence GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH.
92 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
XP_375065
KIAA1762, MGC141820, zinc finger homeobox 2, zinc finger homeodomain protein 2, zinc finger protein 409
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
85446
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit