Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZFP28 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180348

 View more versions of this product

Catalog No. NBP180348


Add to cart

Description

Description

ZFP28 Polyclonal antibody specifically detects ZFP28 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

ZFP28
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZFP28
Synthetic peptide directed towards the middle region of human ZFP28. Peptide sequence RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS.
Immunogen affinity purified
RUO
Primary
140612
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_065879
DKFZp686K03205, KIAA1431, krueppel-like zinc finger factor X6, MGC104540, mkr5, zfp-28, zinc finger factor X6, zinc finger protein 28 homolog, zinc finger protein 28 homolog (mouse)
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit