Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Zfp472 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191625

 View more versions of this product

Catalog No. NBP191625


Add to cart

Description

Description

Zfp472 Polyclonal antibody specifically detects Zfp472 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine samples. It is validated for Western Blot.
Specifications

Specifications

Zfp472
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZFP472
Synthetic peptide directed towards ZFP472. Peptide sequence TLGEWTMLDSSQKKLYRDVMKETFLNLISIGKTEEEDTEEEYQNPKGNLR.
Immunogen affinity purified
RUO
Primary
224691
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_694703
Krab box proteins interacting with myc 1, Krim-1A, Krim-1B, zin finger protein 472, zinc finger protein 472
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 85%; Rat: 85%.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit