Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP90 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZFP90 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179411
|
Novus Biologicals
NBP179411 |
100 μL |
Each for $436.00
|
|
NBP179420UL
|
Novus Biologicals
NBP17941120UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ZFP90 Polyclonal specifically detects ZFP90 in Human samples. It is validated for Western Blot.Specifications
| ZFP90 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KIAA1954, NK10, zfp-90, zinc finger protein 476, zinc finger protein 756, zinc finger protein 90 homolog, zinc finger protein 90 homolog (mouse), ZNF756 | |
| ZFP90 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_597715 | |
| 146198 | |
| Synthetic peptide directed towards the middle region of human ZFP90The immunogen for this antibody is ZFP90. Peptide sequence SSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title