Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFYVE1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZFYVE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179426
|
Novus Biologicals
NBP179426 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZFYVE1 Polyclonal specifically detects ZFYVE1 in Human samples. It is validated for Western Blot.Specifications
| ZFYVE1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DFCP1, DFCP1phosphoinositide-binding protein SR3, Double FYVE-containing protein 1, KIAA1589tandem FYVE fingers-1 protein, SR3, TAFF1zinc finger FYVE domain-containing protein 1, Tandem FYVE fingers-1, zinc finger protein, subfamily 2A (FYVE domain containing), 1, zinc finger, FYVE domain containing 1, ZNFN2A1zinc finger protein, subfamily 2A, member 1 | |
| ZFYVE1 | |
| IgG | |
| Affinity Purified | |
| 40 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_848535 | |
| 53349 | |
| Synthetic peptide directed towards the N terminal of human ZFYVE1The immunogen for this antibody is ZFYVE1. Peptide sequence GVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title