Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZHX2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310465100UL
Description
ZHX2 Polyclonal specifically detects ZHX2 in Mouse samples. It is validated for Western Blot.Specifications
ZHX2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Zona pellucida glycoprotein 2, zona pellucida glycoprotein 2 (sperm receptor), zona pellucida glycoprotein ZP2, Zona pellucida protein A, zona pellucida sperm-binding protein 2, Zp-2, ZPA | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ZHX2 (NP_955520). Peptide sequence RGRDAVSRKVAKQVAESPKNGSEAAHQYAKDPKALSEEDSEKLVPRMKVG | |
100 μg | |
Apoptosis, Cancer, Tumor Suppressors | |
22882 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction