Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZIC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZIC4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180376
|
Novus Biologicals
NBP180376 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZIC4 Polyclonal specifically detects ZIC4 in Human samples. It is validated for Western Blot.Specifications
| ZIC4 | |
| Polyclonal | |
| Rabbit | |
| NP_115529 | |
| 84107 | |
| Synthetic peptide directed towards the middle region of human ZIC4. Peptide sequence RKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ42609, FLJ45833, Zic family member 4, Zinc finger protein of the cerebellum 4zinc family member 4 protein HZIC4, zinc finger protein ZIC 4 | |
| ZIC4 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title