Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Zinc finger protein 395 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31096825UL

 View more versions of this product

Catalog No. NB126836

Add to cart



Zinc finger protein 395 Polyclonal specifically detects Zinc finger protein 395 in Human samples. It is validated for Western Blot.


Zinc finger protein 395
PBS buffer, 2% sucrose
dJ874C20.2, FLJ23407, zinc finger protein 310 pseudogene, zinc finger protein 323, ZNF20-Lp, ZNF310P
The immunogen is a synthetic peptide directed towards the middle region of human Zinc finger protein 395 (NP_061130). Peptide sequence SGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEP
25 μg
DNA Repair, DNA replication Transcription Translation and Splicing
Western Blot
Western Blot 1.0 ug/ml
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit