Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Zinc finger protein 833 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP179360
Description
Zinc finger protein 833 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
Zinc finger protein 833 | |
Unconjugated | |
Affinity Purified | |
zinc finger protein 833, pseudogene, ZNF833 | |
ZNF833P | |
Synthetic peptide directed towards the N terminal of human LOC401898. Peptide sequence MVMHSEDEPYKCKFCGKAFDNLHLYLTHERTHTGEKPYECNKCGKAFSCS. | |
Polyclonal | |
Immunogen affinity purified | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. | |
Expected identity based on immunogen sequence: Human: 100%. |
Western Blot | |
Western Blot 1:1000 | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
401898 | |
Rabbit | |
IgG | |
Primary | |
100 ul | |
RUO | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title