Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZMYND19 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17941420UL

 View more versions of this product

Catalog No. NBP17941420


Add to cart

Description

Description

ZMYND19 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ZMYND19
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ZMYND19
Synthetic peptide directed towards the middle region of human ZMYND19The immunogen for this antibody is ZMYND19. Peptide sequence GWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDV.
Immunogen affinity purified
RUO
Primary
116225
Western Blot
Western Blot 1:1000
NP_612471
MCH-R1-interacting zinc finger protein, Melanin-concentrating hormone receptor 1-interacting zinc finger protein, MIZIPmelanin-concentrating hormone receptor 1 interacting zinc-finger protein, RP11-48C7.4, zinc finger MYND domain-containing protein 19, zinc finger, MYND domain containing 19, zinc finger, MYND-type containing 19
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit