Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF101 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ZNF101
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP168923
View Documents
Novus Biologicals
NBP168923
100 μL
Each for $436.00
Add to cart
 
NBP16892320
View Documents
Novus Biologicals
NBP16892320UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

ZNF101 Polyclonal specifically detects ZNF101 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF101
Polyclonal
Rabbit
Human
DKFZp570I0164, HZF12, MGC149565, MGC149566, zinc finger protein 101, zinc finger protein 101 (Y2), zinc finger protein 12, Zinc finger protein HZF12
ZNF101
IgG
Affinity Purified
50 kDa
Western Blot
Unconjugated
RUO
Q8IZC7
94039
Synthetic peptides corresponding to ZNF101 (zinc finger protein 101) The peptide sequence was selected from the N terminal of ZNF101. Peptide sequence EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit