Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF101 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF101 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168923
|
Novus Biologicals
NBP168923 |
100 μL |
Each for $436.00
|
|
NBP16892320
|
Novus Biologicals
NBP16892320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ZNF101 Polyclonal specifically detects ZNF101 in Human samples. It is validated for Western Blot.Specifications
ZNF101 | |
Polyclonal | |
Rabbit | |
Human | |
DKFZp570I0164, HZF12, MGC149565, MGC149566, zinc finger protein 101, zinc finger protein 101 (Y2), zinc finger protein 12, Zinc finger protein HZF12 | |
ZNF101 | |
IgG | |
Affinity Purified | |
50 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8IZC7 | |
94039 | |
Synthetic peptides corresponding to ZNF101 (zinc finger protein 101) The peptide sequence was selected from the N terminal of ZNF101. Peptide sequence EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title