ZNF154 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179273

Catalog No. NBP179273

Description

ZNF154 Polyclonal specifically detects ZNF154 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF154
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001078853
• Gene Symbols: ZNF154
• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF154The immunogen for this antibody is ZNF154. Peptide sequence QRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 84%.
• Target Species: Human, Porcine, Equine
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA2003, MGC176628, MGC176661, pHZ-92, zinc finger protein 154
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7710
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.