Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF17 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180203
Description
ZNF17 Polyclonal specifically detects ZNF17 in Human samples. It is validated for Western Blot.Specifications
ZNF17 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_008890 | |
ZNF17 | |
Synthetic peptide directed towards the N terminal of human ZNF17. Peptide sequence NLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGVEAFQSGQNNYSCTQC. | |
Affinity Purified | |
RUO | |
7565 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10, zinc finger protein 17, zinc finger protein 17 (HPF3, KOX 10), zinc finger protein HPF3, zinc finger protein KOX10 | |
Rabbit | |
53 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title