Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ZNF17
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180203
View Documents
Novus Biologicals
NBP180203
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ZNF17 Polyclonal specifically detects ZNF17 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF17
Polyclonal
Rabbit
Human
FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10, zinc finger protein 17, zinc finger protein 17 (HPF3, KOX 10), zinc finger protein HPF3, zinc finger protein KOX10
ZNF17
IgG
Affinity Purified
53 kDa
Western Blot
Unconjugated
RUO
NP_008890
7565
Synthetic peptide directed towards the N terminal of human ZNF17. Peptide sequence NLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGVEAFQSGQNNYSCTQC.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit