Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF18 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen ZNF18
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123392
View Documents
Novus Biologicals
NBP30924525UL
25 μg
Each for $106.19
Add to cart
 
NB123391
View Documents
Novus Biologicals
NBP309245100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

ZNF18 Polyclonal antibody specifically detects ZNF18 in Human samples. It is validated for Western Blot
Specifications

Specifications

ZNF18
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
7566
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
HDSG1Zinc finger protein 535, heart development-specific protein, KOX11Heart development-specific gene 1 protein, Zfp535, zinc finger protein 18, zinc finger protein 18 (KOX 11), ZKSCAN6Zinc finger protein KOX11, ZNF535Zinc finger protein with KRAB and SCAN domains 6
The immunogen is a synthetic peptide directed towards the middle region of human ZNF18 (NP_653281). Peptide sequence LSPQERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit