Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF19 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153032

 View more versions of this product

Catalog No. NBP153032


Add to cart

Description

Description

ZNF19 Polyclonal antibody specifically detects ZNF19 in Human, Yeast samples. It is validated for Western Blot.
Specifications

Specifications

ZNF19
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ZNF19
Synthetic peptides corresponding to ZNF19(zinc finger protein 19) The peptide sequence was selected from the C terminal of ZNF19. Peptide sequence HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP.
Protein A purified
RUO
Primary
7567
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
P17023
KOX12MGC51021, zinc finger protein 19, zinc finger protein 19 (KOX 12), Zinc finger protein KOX12
Rabbit
IgG
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%.
Human, Yeast
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit