Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF227 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ZNF227 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180193
|
Novus Biologicals
NBP180193 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ZNF227 Polyclonal specifically detects ZNF227 in Human samples. It is validated for Western Blot.Specifications
ZNF227 | |
Polyclonal | |
Rabbit | |
NP_872296 | |
7770 | |
Synthetic peptide directed towards the N terminal of human ZNF227. Peptide sequence QIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1084, zinc finger protein 507 | |
ZNF227 | |
IgG | |
92 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title