Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191519
Description
ZNF252 Polyclonal specifically detects ZNF252 in Human samples. It is validated for Western Blot.Specifications
ZNF252 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ZNF252P zinc finger protein 252, pseudogene | |
Rabbit | |
75 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
ZNF252 | |
Synthetic peptide directed towards the middle region of human ZNF252. Peptide sequence QRIHTGEKPYECNECAKSFSLNRTLTVHQRIHTGEKPYRCNECGKSFSQCS. | |
Affinity Purified | |
RUO | |
286101 | |
Human, Canine, Equine | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction