Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF264 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF264 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180298
|
Novus Biologicals
NBP180298 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF264 Polyclonal specifically detects ZNF264 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZNF264 | |
Unconjugated | |
RUO | |
KIAA0412, zinc finger protein 264 | |
ZNF264 | |
IgG | |
Affinity Purified |
Polyclonal | |
Rabbit | |
NP_003408 | |
9422 | |
Synthetic peptide directed towards the C terminal of human ZNF264. Peptide sequence SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title