Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF274 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen ZNF274
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125948
View Documents
Novus Biologicals
NBP31052325UL
25 μg
Each for $106.19
Add to cart
 
NB125947
View Documents
Novus Biologicals
NBP310523100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

ZNF274 Polyclonal antibody specifically detects ZNF274 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

ZNF274
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
PBS buffer, 2% sucrose
10782
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Human
GIOT2, GIOT-2, gonadotropin inducible transcription repressor-2, Gonadotropin-inducible ovary transcription repressor 2, gonadotropin-inducible transcription repressor 2, KOX7DKFZp434F1811, zinc finger protein 44, zinc finger protein 44 (KOX 7), Zinc finger protein 55DKFZp686L21136, Zinc finger protein 58ZNF504, Zinc finger protein KOX7, zinc finger protein ZnFP12, ZNF, ZNF55, ZNF58
The immunogen is a synthetic peptide directed towards the middle region of human ZNF274 (NP_057408). Peptide sequence SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit