Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF286 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18011920UL
Description
ZNF286 Polyclonal specifically detects ZNF286 in Human samples. It is validated for Western Blot.Specifications
ZNF286 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_065703 | |
ZNF286A | |
Synthetic peptide directed towards the N terminal of human ZNF286. Peptide sequence GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK. | |
Affinity Purified | |
RUO | |
57335 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
MGC149627, zinc finger protein 286, zinc finger protein 286A | |
Rabbit | |
60 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title