Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF286 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen ZNF286
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB8011920UL
View Documents
Novus Biologicals
NBP18011920UL
20 μL
Each for $152.22
Add to cart
 
NBP180119
View Documents
Novus Biologicals
NBP180119
100 μL
Each for $436.00
Add to cart
 
Description

Description

ZNF286 Polyclonal specifically detects ZNF286 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF286
Polyclonal
Rabbit
Human
MGC149627, zinc finger protein 286, zinc finger protein 286A
ZNF286A
IgG
Affinity Purified
60 kDa
Western Blot
Unconjugated
RUO
NP_065703
57335
Synthetic peptide directed towards the N terminal of human ZNF286. Peptide sequence GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit