Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF297B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ZNF297B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180326
View Documents
Novus Biologicals
NBP180326
100 μL
Each for $436.00
Add to cart
 
NBP18032620
View Documents
Novus Biologicals
NBP18032620UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

ZNF297B Polyclonal specifically detects ZNF297B in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF297B
Polyclonal
Rabbit
NP_054726
23099
Synthetic peptide directed towards the N terminal of human ZBTB43. Peptide sequence EPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
KIAA0414, ZBTB22BZNF-X, zinc finger and BTB domain containing 43, Zinc finger and BTB domain-containing protein 22B, zinc finger and BTB domain-containing protein 43, Zinc finger protein 297BFLJ22470, ZNF297B, ZnF-x
ZBTB43
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit