Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF297B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF297B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180326
|
Novus Biologicals
NBP180326 |
100 μL |
Each for $436.00
|
|
NBP18032620
|
Novus Biologicals
NBP18032620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ZNF297B Polyclonal specifically detects ZNF297B in Human samples. It is validated for Western Blot.Specifications
| ZNF297B | |
| Polyclonal | |
| Rabbit | |
| NP_054726 | |
| 23099 | |
| Synthetic peptide directed towards the N terminal of human ZBTB43. Peptide sequence EPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA0414, ZBTB22BZNF-X, zinc finger and BTB domain containing 43, Zinc finger and BTB domain-containing protein 22B, zinc finger and BTB domain-containing protein 43, Zinc finger protein 297BFLJ22470, ZNF297B, ZnF-x | |
| ZBTB43 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title