Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF297B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191622

 View more versions of this product

Catalog No. NBP191622


Add to cart

Description

Description

ZNF297B Polyclonal antibody specifically detects ZNF297B in Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

ZNF297B
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZBTB43
Synthetic peptide directed towards ZBTB43. Peptide sequence HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN.
Immunogen affinity purified
RUO
Primary
23099
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_082223
KIAA0414, ZBTB22BZNF-X, zinc finger and BTB domain containing 43, Zinc finger and BTB domain-containing protein 22B, zinc finger and BTB domain-containing protein 43, Zinc finger protein 297BFLJ22470, ZNF297B, ZnF-x
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Chicken: 78%.
Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit