Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF30 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ZNF30
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180199
View Documents
Novus Biologicals
NBP180199
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ZNF30 Polyclonal specifically detects ZNF30 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF30
Polyclonal
Rabbit
NP_919306
90075
Synthetic peptide directed towards the middle region of human ZNF30. Peptide sequence YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
DKFZp686N19164, FLJ20562, KOX28, zinc finger protein 30, zinc finger protein 30 (KOX 28), zinc finger protein KOX28
ZNF30
IgG
Affinity Purified
71 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit