Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF300 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ZNF300 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180134
|
Novus Biologicals
NBP180134 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ZNF300 Polyclonal specifically detects ZNF300 in Human samples. It is validated for Western Blot.Specifications
ZNF300 | |
Polyclonal | |
Rabbit | |
NP_443092 | |
91975 | |
Synthetic peptide directed towards the N terminal of human ZNF300. Peptide sequence DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
kruppel-like zinc finger protein, zinc finger protein 300 | |
ZNF300 | |
IgG | |
69 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title