Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF318 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310946100UL

 View more versions of this product

Catalog No. NB126791

Add to cart



ZNF318 Polyclonal antibody specifically detects ZNF318 in Human samples. It is validated for Western Blot, Immunohistochemistry


PBS buffer, 2% sucrose
Zinc finger and SCAN domain-containing protein 15, zinc finger protein 397, Zinc finger protein 47ZSCAN15MGC13250, ZNF47
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF318 (NP_055160). Peptide sequence SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH
100 μg
Chromatin Research
Western Blot, Immunohistochemistry
Western Blot 1.0 ug/ml, Immunohistochemistry
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit