Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF318 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen ZNF318
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126792
View Documents
Novus Biologicals
NBP31094625UL
25 μg
Each for $106.19
Add to cart
 
NB126791
View Documents
Novus Biologicals
NBP310946100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

ZNF318 Polyclonal antibody specifically detects ZNF318 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

ZNF318
Western Blot, Immunohistochemistry
Purified
RUO
Human
Zinc finger and SCAN domain-containing protein 15, zinc finger protein 397, Zinc finger protein 47ZSCAN15MGC13250, ZNF47
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF318 (NP_055160). Peptide sequence SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Chromatin Research
PBS buffer, 2% sucrose
24149
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit