Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF334 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF334 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179707
|
Novus Biologicals
NBP179707 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF334 Polyclonal specifically detects ZNF334 in Human samples. It is validated for Western Blot.Specifications
ZNF334 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp586G1122, Hzf, HZFzinc finger protein 385, RZFHematopoietic zinc finger protein, ZFP385, zinc finger protein 385A, ZNF385Retinal zinc finger protein | |
ZNF334 | |
IgG | |
Affinity Purified | |
80 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_060572 | |
55713 | |
Synthetic peptide directed towards the N terminal of human ZNF334The immunogen for this antibody is ZNF334. Peptide sequence KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title