Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF382 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ZNF382 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18038020
|
Novus Biologicals
NBP18038020UL |
20 μL |
Each for $152.22
|
|
NBP180380
|
Novus Biologicals
NBP180380 |
100 μL |
Each for $436.00
|
|
Description
ZNF382 Polyclonal specifically detects ZNF382 in Human samples. It is validated for Western Blot.Specifications
| ZNF382 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_116214 | |
| 84911 | |
| Synthetic peptide directed towards the N terminal of human ZNF382. Peptide sequence MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| zinc finger protein 382 | |
| ZNF382 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title