Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF445 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | ZNF445 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125789
|
Novus Biologicals
NBP310444100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
ZNF445 Polyclonal specifically detects ZNF445 in Mouse samples. It is validated for Western Blot.Specifications
| ZNF445 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| zinc finger protein 168, zinc finger protein 445, zinc finger protein with KRAB and SCAN domains 15, ZKSCAN15, ZNF168 | |
| The immunogen is a synthetic peptide directed towards the middle region of Mouse ZNF445 (NP_775540). Peptide sequence NFRKSSHHYNNKYGEGLRGTGEGFGVYQNTGLKENGKDRYGETSRKSWHA | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 353274 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title