Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF474 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF474 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179974
|
Novus Biologicals
NBP179974 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF474 Polyclonal specifically detects ZNF474 in Human samples. It is validated for Western Blot.Specifications
ZNF474 | |
Polyclonal | |
Rabbit | |
NP_997200 | |
133923 | |
Synthetic peptide directed towards the middle region of human ZNF474. Peptide sequence NDRLPVELHQPLPQKPQPLPNAQSSQAGPNQAQLVFCPHCSRIFTSDRLL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
4933409D10Rik, testis-specific zinc finger protein, TSZFP, zinc finger protein 474 | |
ZNF474 | |
IgG | |
Affinity Purified | |
40 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title