Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF486 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ZNF486
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179461
View Documents
Novus Biologicals
NBP179461
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ZNF486 Polyclonal specifically detects ZNF486 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF486
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
KOX16MGC57283, Zfp612, zinc finger protein 23, zinc finger protein 23 (KOX 16), zinc finger protein 32, Zinc finger protein 359ZNF612kruppel-like zinc finger factor X31, Zinc finger protein 612, Zinc finger protein KOX16, ZNF359
ZNF486
IgG
Affinity Purified
54 kDa
Western Blot
Unconjugated
RUO
NP_443084
90649
Synthetic peptide directed towards the middle region of human ZNF486The immunogen for this antibody is ZNF486. Peptide sequence HKIIHTGEQPYKCKECDKAFNHPATLSSHKKIHTGEKPYTCDKCGKAFIS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit