Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF486 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF486 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179461
|
Novus Biologicals
NBP179461 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF486 Polyclonal specifically detects ZNF486 in Human samples. It is validated for Western Blot.Specifications
| ZNF486 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KOX16MGC57283, Zfp612, zinc finger protein 23, zinc finger protein 23 (KOX 16), zinc finger protein 32, Zinc finger protein 359ZNF612kruppel-like zinc finger factor X31, Zinc finger protein 612, Zinc finger protein KOX16, ZNF359 | |
| ZNF486 | |
| IgG | |
| Affinity Purified | |
| 54 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_443084 | |
| 90649 | |
| Synthetic peptide directed towards the middle region of human ZNF486The immunogen for this antibody is ZNF486. Peptide sequence HKIIHTGEQPYKCKECDKAFNHPATLSSHKKIHTGEKPYTCDKCGKAFIS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title