Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF488 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF488 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180422
|
Novus Biologicals
NBP180422 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF488 Polyclonal specifically detects ZNF488 in Human samples. It is validated for Western Blot.Specifications
| ZNF488 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_694579 | |
| 118738 | |
| Synthetic peptide directed towards the C terminal of human ZNF488. Peptide sequence VFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FDZF2Zinc finger protein FDZF2, zinc finger protein 230 | |
| ZNF488 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title