Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF499 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF499 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179966
|
Novus Biologicals
NBP179966 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF499 Polyclonal specifically detects ZNF499 in Human samples. It is validated for Western Blot.Specifications
ZNF499 | |
Polyclonal | |
Rabbit | |
NP_116181 | |
84878 | |
Synthetic peptide directed towards the middle region of human ZNF499. Peptide sequence: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp547H249, FLJ14486, zinc finger and BTB domain containing 45, zinc finger and BTB domain-containing protein 45, zinc finger protein 499, ZNF499 | |
ZBTB45 | |
IgG | |
Affinity Purified | |
54 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title