Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF502 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ZNF502
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180130
View Documents
Novus Biologicals
NBP180130
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ZNF502 Polyclonal specifically detects ZNF502 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF502
Polyclonal
Rabbit
NP_149987
91392
Synthetic peptide directed towards the N terminal of human ZNF502. Peptide sequence IDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
KOX17Zinc finger protein 191, lacks zinc finger domain, Retinoic acid suppression protein A, RSG-A, Zfp191, Zinc finger and SCAN domain-containing protein 3, zinc finger protein 24, zinc finger protein 24 (KOX 17), ZNF191, ZSCAN3Zinc finger protein KOX17
ZNF502
IgG
Affinity Purified
63 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit