Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF502 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF502 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180130
|
Novus Biologicals
NBP180130 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF502 Polyclonal specifically detects ZNF502 in Human samples. It is validated for Western Blot.Specifications
| ZNF502 | |
| Polyclonal | |
| Rabbit | |
| NP_149987 | |
| 91392 | |
| Synthetic peptide directed towards the N terminal of human ZNF502. Peptide sequence IDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KOX17Zinc finger protein 191, lacks zinc finger domain, Retinoic acid suppression protein A, RSG-A, Zfp191, Zinc finger and SCAN domain-containing protein 3, zinc finger protein 24, zinc finger protein 24 (KOX 17), ZNF191, ZSCAN3Zinc finger protein KOX17 | |
| ZNF502 | |
| IgG | |
| Affinity Purified | |
| 63 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title