Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF511 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | ZNF511 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18027920
|
Novus Biologicals
NBP18027920UL |
20 μL |
Each for $152.22
|
|
NBP180279
|
Novus Biologicals
NBP180279 |
100 μL |
Each for $436.00
|
|
Description
ZNF511 Polyclonal specifically detects ZNF511 in Human samples. It is validated for Western Blot.Specifications
ZNF511 | |
Polyclonal | |
Rabbit | |
NP_665805 | |
118472 | |
Synthetic peptide directed towards the N terminal of human ZNF511. Peptide sequence MQLPPALCARLAAGPGAAEPLPVERDPAAGAAPFRFVARPVRFPREHQFF. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
BMZF3, BMZF-3Bone marrow zinc finger 3, zinc finger protein 256 | |
ZNF511 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title