Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF512 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17996720UL

 View more versions of this product

Catalog No. NBP17996720

Add to cart



ZNF512 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS & 2% Sucrose. with No Preservative
Affinity Purified
Synthetic peptide directed towards the middle region of human ZNF512. Peptide sequence QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM.
65 kDa
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1:1000
FLJ51176, KIAA1805, MGC111046, zinc finger protein 512
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit