Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF549 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF549 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180425
|
Novus Biologicals
NBP180425 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF549 Polyclonal specifically detects ZNF549 in Human samples. It is validated for Western Blot.Specifications
ZNF549 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ34917, zinc finger protein 549 | |
ZNF549 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_694995 | |
256051 | |
Synthetic peptide directed towards the middle region of human ZNF549. Peptide sequence TACEKAFIYKNKLVEHQRIHTGEKPYECGKCGKAFNKRYSLVRHQKVHIT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title