Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF567 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18041220UL
Description
ZNF567 Polyclonal specifically detects ZNF567 in Human samples. It is validated for Western Blot.Specifications
ZNF567 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_689816 | |
ZNF567 | |
Synthetic peptide directed towards the N terminal of human ZNF567. Peptide sequence TSFAGHTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
MGC45586, zinc finger protein 567 | |
Rabbit | |
Affinity Purified | |
RUO | |
163081 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title