Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF570 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180395

 View more versions of this product

Catalog No. NBP180395


Add to cart

Description

Description

ZNF570 Polyclonal antibody specifically detects ZNF570 in Human, Bovine, Canine, Equine, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

ZNF570
LYOPH
Western Blot 1:1000
NP_653295
zinc finger protein 570
Rabbit
IgG
50 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Bovine: 92%; Pig: 92%; Rabbit: 85%.
Bovine, Canine, Equine, Human, Rabbit
Western Blot
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZNF570
Synthetic peptide directed towards the middle region of human ZNF570. Peptide sequence AQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQV.
Immunogen affinity purified
RUO
Primary
148268
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit