Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF570 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18039520UL

 View more versions of this product

Catalog No. NBP18039520

Add to cart



ZNF570 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Western Blot 1:1000
zinc finger protein 570
20 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Western Blot
PBS & 2% Sucrose. with No Preservative
Affinity Purified
Synthetic peptide directed towards the middle region of human ZNF570. Peptide sequence AQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQV.
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit