Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF572 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF572 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180157
|
Novus Biologicals
NBP180157 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF572 Polyclonal specifically detects ZNF572 in Human samples. It is validated for Western Blot.Specifications
ZNF572 | |
Polyclonal | |
Rabbit | |
NP_689625 | |
137209 | |
Synthetic peptide directed towards the middle region of human ZNF572. Peptide sequence YKCTSCEKCFSRSAYLSQHRKIHVEKPFESPDVGDFPHEWTWKNCSGEMP. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
FLJ38002, zinc finger protein 572 | |
ZNF572 | |
IgG | |
Affinity Purified | |
61 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title