Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF582 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180142

 View more versions of this product

Catalog No. NBP180142


Add to cart

Description

Description

ZNF582 Polyclonal antibody specifically detects ZNF582 in Human, Porcine, Equine samples. It is validated for Western Blot.
Specifications

Specifications

ZNF582
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZNF582
Synthetic peptide directed towards the N terminal of human ZNF582. Peptide sequence SGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQDD.
60 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Porcine: 79%.
Equine, Human, Porcine
Western Blot
Western Blot 1:1000
NP_653291
FLJ30927, zinc finger protein 582
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
147948
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit