Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF587 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ZNF587 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180381
|
Novus Biologicals
NBP180381 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ZNF587 Polyclonal specifically detects ZNF587 in Human samples. It is validated for Western Blot.Specifications
ZNF587 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ14710, FLJ20813, ZF6, zinc finger protein 587, zinc finger protein zfp6 | |
ZNF587 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_116217 | |
84914 | |
Synthetic peptide directed towards the middle region of human ZNF587. Peptide sequence CGKSFSECSSLIKHRRIHTGERPYECTKCGKTFQRSSTLLHHQSSHRRKA. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title