Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF607 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen ZNF607
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1802520
View Documents
Novus Biologicals
NBP18012520UL
20 μL
Each for $152.22
Add to cart
 
NBP180125
View Documents
Novus Biologicals
NBP180125
100 μL
Each for $436.00
Add to cart
 
Description

Description

ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF607
Polyclonal
Rabbit
Human
FLJ14802, MGC13071, zinc finger protein 607
ZNF607
IgG
Affinity Purified
81 kDa
Western Blot
Unconjugated
RUO
NP_116078
84775
Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit