Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF645 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF645 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180410
|
Novus Biologicals
NBP180410 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF645 Polyclonal specifically detects ZNF645 in Human samples. It is validated for Western Blot.Specifications
| ZNF645 | |
| Polyclonal | |
| Rabbit | |
| NP_689790 | |
| 158506 | |
| Synthetic peptide directed towards the middle region of human ZNF645. Peptide sequence LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| E3 ubiquitin ligase, HAKAIL, zinc finger protein 645 | |
| ZNF645 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title