Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF664 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179467

 View more versions of this product

Catalog No. NBP179467


Add to cart

Description

Description

ZNF664 Polyclonal antibody specifically detects ZNF664 in Human, Mouse, Rat, Bovine, Canine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

ZNF664
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ZNF664
Synthetic peptide directed towards the N terminal of human ZNF664The immunogen for this antibody is ZNF664. Peptide sequence FFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKC.
30 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_689650
DKFZp761B128, MGC126579, ZFOC1zinc finger Organ of Corti 1, Zinc finger protein 176ZNF176, zinc finger protein 664, Zinc finger protein from organ of Corti, ZNF196
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
144348
Bovine, Canine, Guinea Pig, Human, Mouse, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit